Anti USH1G pAb (ATL-HPA024360)

Atlas Antibodies

Catalog No.: ATL-HPA024360-25

Protein Description: Usher syndrome 1G (autosomal recessive)
Gene Name: USH1G
Alternative Gene Name: ANKS4A, FLJ33924, Sans
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045288: 97%, ENSRNOG00000028456: 97%
Entrez Gene ID: 124590
Uniprot ID: Q495M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
• Gene Sequence: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
• Gene ID - Mouse: ENSMUSG00000045288
• Gene ID - Rat: ENSRNOG00000028456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.