Anti UROS pAb (ATL-HPA044038 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044038-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: uroporphyrinogen III synthase
Gene Name: UROS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030979: 71%, ENSRNOG00000017810: 69%
Entrez Gene ID: 7390
Uniprot ID: P10746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLKREILPKALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTT
Gene Sequence NLKREILPKALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTT
Gene ID - Mouse ENSMUSG00000030979
Gene ID - Rat ENSRNOG00000017810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UROS pAb (ATL-HPA044038 w/enhanced validation)
Datasheet Anti UROS pAb (ATL-HPA044038 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UROS pAb (ATL-HPA044038 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UROS pAb (ATL-HPA044038 w/enhanced validation)
Datasheet Anti UROS pAb (ATL-HPA044038 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UROS pAb (ATL-HPA044038 w/enhanced validation)