Anti UQCRC2 pAb (ATL-HPA007998 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007998-25

Protein Description: ubiquinol-cytochrome c reductase core protein II
Gene Name: UQCRC2
Alternative Gene Name: QCR2, UQCR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030884: 86%, ENSRNOG00000036742: 85%
Entrez Gene ID: 7385
Uniprot ID: P22695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQN
• Gene Sequence: IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQN
• Gene ID - Mouse: ENSMUSG00000030884
• Gene ID - Rat: ENSRNOG00000036742
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UQCRC2 pAb (ATL-HPA007998 w/enhanced validation) – 2 Found

Lai, Deborah; Tan, Chye Ling; Gunaratne, Jayantha; Quek, Ling Shih; Nei, Wenlong; Thierry, Françoise; Bellanger, Sophie. Localization of HPV-18 E2 at mitochondrial membranes induces ROS release and modulates host cell metabolism. Plos One. 8(9):e75625. 

Ni, Yang; Hagras, Muhammad A; Konstantopoulou, Vassiliki; Mayr, Johannes A; Stuchebrukhov, Alexei A; Meierhofer, David. Mutations in NDUFS1 Cause Metabolic Reprogramming and Disruption of the Electron Transfer. Cells. 2019;8(10)