Anti UQCRB pAb (ATL-HPA043060)

Atlas Antibodies

Catalog No.: ATL-HPA043060-25

Protein Description: ubiquinol-cytochrome c reductase binding protein
Gene Name: UQCRB
Alternative Gene Name: QCR7, QP-C, UQBP, UQCR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021520: 89%, ENSRNOG00000032204: 90%
Entrez Gene ID: 7381
Uniprot ID: P14927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
• Gene Sequence: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
• Gene ID - Mouse: ENSMUSG00000021520
• Gene ID - Rat: ENSRNOG00000032204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UQCRB pAb (ATL-HPA043060) – 3 Found

Kim, Hyun-Chul; Chang, Junghwa; Lee, Hannah S; Kwon, Ho Jeong. Mitochondrial UQCRB as a new molecular prognostic biomarker of human colorectal cancer. Experimental & Molecular Medicine. 2017;49(11):e391. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Zhang, Shan; Reljić, Boris; Liang, Chao; Kerouanton, Baptiste; Francisco, Joel Celio; Peh, Jih Hou; Mary, Camille; Jagannathan, Narendra Suhas; Olexiouk, Volodimir; Tang, Claire; Fidelito, Gio; Nama, Srikanth; Cheng, Ruey-Kuang; Wee, Caroline Lei; Wang, Loo Chien; Duek Roggli, Paula; Sampath, Prabha; Lane, Lydie; Petretto, Enrico; Sobota, Radoslaw M; Jesuthasan, Suresh; Tucker-Kellogg, Lisa; Reversade, Bruno; Menschaert, Gerben; Sun, Lei; Stroud, David A; Ho, Lena. Mitochondrial peptide BRAWNIN is essential for vertebrate respiratory complex III assembly. Nature Communications. 2020;11(1):1312.