Anti UQCC2 pAb (ATL-HPA039111)

Atlas Antibodies

Catalog No.: ATL-HPA039111-25

Protein Description: ubiquinol-cytochrome c reductase complex assembly factor 2
Gene Name: UQCC2
Alternative Gene Name: bA6B20.2, C6orf125, Cbp6, M19, MGC14833, MNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024208: 82%, ENSRNOG00000025909: 77%
Entrez Gene ID: 84300
Uniprot ID: Q9BRT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEADDKA
• Gene Sequence: NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEADDKA
• Gene ID - Mouse: ENSMUSG00000024208
• Gene ID - Rat: ENSRNOG00000025909
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UQCC2 pAb (ATL-HPA039111) – 1 Found

Dalton, W Brian; Helmenstine, Eric; Walsh, Noel; Gondek, Lukasz P; Kelkar, Dhanashree S; Read, Abigail; Natrajan, Rachael; Christenson, Eric S; Roman, Barbara; Das, Samarjit; Zhao, Liang; Leone, Robert D; Shinn, Daniel; Groginski, Taylor; Madugundu, Anil K; Patil, Arun; Zabransky, Daniel J; Medford, Arielle; Lee, Justin; Cole, Alex J; Rosen, Marc; Thakar, Maya; Ambinder, Alexander; Donaldson, Joshua; DeZern, Amy E; Cravero, Karen; Chu, David; Madero-Marroquin, Rafael; Pandey, Akhilesh; Hurley, Paula J; Lauring, Josh; Park, Ben Ho. Hotspot SF3B1 mutations induce metabolic reprogramming and vulnerability to serine deprivation. The Journal Of Clinical Investigation. 2019;129(11):4708-4723.