Anti UNK pAb (ATL-HPA027962)

Atlas Antibodies

Catalog No.: ATL-HPA027962-25

Protein Description: unkempt family zinc finger
Gene Name: UNK
Alternative Gene Name: KIAA1753, ZC3H5, ZC3HDC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020770: 89%, ENSRNOG00000006600: 86%
Entrez Gene ID: 85451
Uniprot ID: Q9C0B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES
• Gene Sequence: IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES
• Gene ID - Mouse: ENSMUSG00000020770
• Gene ID - Rat: ENSRNOG00000006600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.