Anti UNC93A pAb (ATL-HPA035729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035729-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UNC93A
Alternative Gene Name: dJ366N23.1, dJ366N23.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067049: 50%, ENSRNOG00000047027: 62%
Entrez Gene ID: 54346
Uniprot ID: Q86WB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR |
| Gene Sequence | QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR |
| Gene ID - Mouse | ENSMUSG00000067049 |
| Gene ID - Rat | ENSRNOG00000047027 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNC93A pAb (ATL-HPA035729) | |
| Datasheet | Anti UNC93A pAb (ATL-HPA035729) Datasheet (External Link) |
| Vendor Page | Anti UNC93A pAb (ATL-HPA035729) at Atlas Antibodies |
| Documents & Links for Anti UNC93A pAb (ATL-HPA035729) | |
| Datasheet | Anti UNC93A pAb (ATL-HPA035729) Datasheet (External Link) |
| Vendor Page | Anti UNC93A pAb (ATL-HPA035729) |