Anti UNC93A pAb (ATL-HPA035729)

Atlas Antibodies

Catalog No.: ATL-HPA035729-25

Protein Description: unc-93 homolog A (C. elegans)
Gene Name: UNC93A
Alternative Gene Name: dJ366N23.1, dJ366N23.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067049: 50%, ENSRNOG00000047027: 62%
Entrez Gene ID: 54346
Uniprot ID: Q86WB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
• Gene Sequence: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
• Gene ID - Mouse: ENSMUSG00000067049
• Gene ID - Rat: ENSRNOG00000047027
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.