Anti UNC45A pAb (ATL-HPA039228)

Atlas Antibodies

Catalog No.: ATL-HPA039228-25

Protein Description: unc-45 homolog A (C. elegans)
Gene Name: UNC45A
Alternative Gene Name: GC-UNC45, SMAP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030533: 82%, ENSRNOG00000012357: 84%
Entrez Gene ID: 55898
Uniprot ID: Q9H3U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
• Gene Sequence: QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
• Gene ID - Mouse: ENSMUSG00000030533
• Gene ID - Rat: ENSRNOG00000012357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UNC45A pAb (ATL-HPA039228) – 1 Found

Li, Qinghong; Zhou, Zhe; Sun, Yue; Sun, Chang; Klappe, Karin; van IJzendoorn, Sven C D. A Functional Relationship Between UNC45A and MYO5B Connects Two Rare Diseases With Shared Enteropathy. Cellular And Molecular Gastroenterology And Hepatology. 14(2):295-310.