Anti UNC45A pAb (ATL-HPA039228)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039228-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UNC45A
Alternative Gene Name: GC-UNC45, SMAP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030533: 82%, ENSRNOG00000012357: 84%
Entrez Gene ID: 55898
Uniprot ID: Q9H3U1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG |
| Gene Sequence | QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG |
| Gene ID - Mouse | ENSMUSG00000030533 |
| Gene ID - Rat | ENSRNOG00000012357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNC45A pAb (ATL-HPA039228) | |
| Datasheet | Anti UNC45A pAb (ATL-HPA039228) Datasheet (External Link) |
| Vendor Page | Anti UNC45A pAb (ATL-HPA039228) at Atlas Antibodies |
| Documents & Links for Anti UNC45A pAb (ATL-HPA039228) | |
| Datasheet | Anti UNC45A pAb (ATL-HPA039228) Datasheet (External Link) |
| Vendor Page | Anti UNC45A pAb (ATL-HPA039228) |
| Citations for Anti UNC45A pAb (ATL-HPA039228) – 1 Found |
| Li, Qinghong; Zhou, Zhe; Sun, Yue; Sun, Chang; Klappe, Karin; van IJzendoorn, Sven C D. A Functional Relationship Between UNC45A and MYO5B Connects Two Rare Diseases With Shared Enteropathy. Cellular And Molecular Gastroenterology And Hepatology. 14(2):295-310. PubMed |