Anti UNC119 pAb (ATL-HPA041912 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041912-25

Protein Description: unc-119 homolog (C. elegans)
Gene Name: UNC119
Alternative Gene Name: HRG4, POC7, POC7A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002058: 98%, ENSRNOG00000011060: 98%
Entrez Gene ID: 9094
Uniprot ID: Q13432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
• Gene Sequence: GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
• Gene ID - Mouse: ENSMUSG00000002058
• Gene ID - Rat: ENSRNOG00000011060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.