Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034697-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: UDP-glucose pyrophosphorylase 2
Gene Name: UGP2
Alternative Gene Name: UGP1, UGPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001891: 99%, ENSRNOG00000008079: 99%
Entrez Gene ID: 7360
Uniprot ID: Q16851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY
Gene Sequence SMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY
Gene ID - Mouse ENSMUSG00000001891
Gene ID - Rat ENSRNOG00000008079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation)
Datasheet Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation)
Datasheet Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation)
Citations for Anti UGP2 pAb (ATL-HPA034697 w/enhanced validation) – 1 Found
Krysa, Samantha J; Allen, Lee-Ann H. Metabolic Reprogramming Mediates Delayed Apoptosis of Human Neutrophils Infected With Francisella tularensis. Frontiers In Immunology. 13( 35693822):836754.  PubMed