Anti UFSP2 pAb (ATL-HPA043298)

Atlas Antibodies

Catalog No.: ATL-HPA043298-25

Protein Description: UFM1-specific peptidase 2
Gene Name: UFSP2
Alternative Gene Name: C4orf20, FLJ11200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031634: 71%, ENSRNOG00000012087: 69%
Entrez Gene ID: 55325
Uniprot ID: Q9NUQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
• Gene Sequence: LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
• Gene ID - Mouse: ENSMUSG00000031634
• Gene ID - Rat: ENSRNOG00000012087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.