Anti UCHL5 pAb (ATL-HPA005908)

Atlas Antibodies

Catalog No.: ATL-HPA005908-25

Protein Description: ubiquitin carboxyl-terminal hydrolase L5
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 100%, ENSRNOG00000003545: 100%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
• Gene Sequence: CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
• Gene ID - Mouse: ENSMUSG00000018189
• Gene ID - Rat: ENSRNOG00000003545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UCHL5 pAb (ATL-HPA005908) – 1 Found

Arpalahti, Leena; Laitinen, Alli; Hagström, Jaana; Mustonen, Harri; Kokkola, Arto; Böckelman, Camilla; Haglund, Caj; Holmberg, Carina I. Positive cytoplasmic UCHL5 tumor expression in gastric cancer is linked to improved prognosis. Plos One. 13(2):e0193125.