Anti UBTD1 pAb (ATL-HPA034825)

Atlas Antibodies

Catalog No.: ATL-HPA034825-25

Protein Description: ubiquitin domain containing 1
Gene Name: UBTD1
Alternative Gene Name: FLJ11807
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025171: 97%, ENSRNOG00000013813: 98%
Entrez Gene ID: 80019
Uniprot ID: Q9HAC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLT
• Gene Sequence: YQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLT
• Gene ID - Mouse: ENSMUSG00000025171
• Gene ID - Rat: ENSRNOG00000013813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBTD1 pAb (ATL-HPA034825) – 1 Found

Yang, Nan; Chen, Tianxiang; Wang, Liang; Liu, Runkun; Niu, Yongshen; Sun, Liankang; Yao, Bowen; Wang, Yufeng; Yang, Wei; Liu, Qingguang; Tu, Kangsheng; Liu, Zhikui. CXCR4 mediates matrix stiffness-induced downregulation of UBTD1 driving hepatocellular carcinoma progression via YAP signaling pathway. Theranostics. 10(13):5790-5801.