Anti UBR3 pAb (ATL-HPA035390)

Atlas Antibodies

Catalog No.:
ATL-HPA035390-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3 component n-recognin 3 (putative)
Gene Name: UBR3
Alternative Gene Name: DKFZp434P117, FLJ37422, KIAA2024, ZNF650
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044308: 87%, ENSRNOG00000008616: 87%
Entrez Gene ID: 130507
Uniprot ID: Q6ZT12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
Gene Sequence DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE
Gene ID - Mouse ENSMUSG00000044308
Gene ID - Rat ENSRNOG00000008616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBR3 pAb (ATL-HPA035390)
Datasheet Anti UBR3 pAb (ATL-HPA035390) Datasheet (External Link)
Vendor Page Anti UBR3 pAb (ATL-HPA035390) at Atlas Antibodies

Documents & Links for Anti UBR3 pAb (ATL-HPA035390)
Datasheet Anti UBR3 pAb (ATL-HPA035390) Datasheet (External Link)
Vendor Page Anti UBR3 pAb (ATL-HPA035390)
Citations for Anti UBR3 pAb (ATL-HPA035390) – 1 Found
Li, Tongchao; Fan, Junkai; Blanco-Sánchez, Bernardo; Giagtzoglou, Nikolaos; Lin, Guang; Yamamoto, Shinya; Jaiswal, Manish; Chen, Kuchuan; Zhang, Jie; Wei, Wei; Lewis, Michael T; Groves, Andrew K; Westerfield, Monte; Jia, Jianhang; Bellen, Hugo J. Ubr3, a Novel Modulator of Hh Signaling Affects the Degradation of Costal-2 and Kif7 through Poly-ubiquitination. Plos Genetics. 2016;12(5):e1006054.  PubMed