Anti UBR3 pAb (ATL-HPA035390)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035390-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UBR3
Alternative Gene Name: DKFZp434P117, FLJ37422, KIAA2024, ZNF650
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044308: 87%, ENSRNOG00000008616: 87%
Entrez Gene ID: 130507
Uniprot ID: Q6ZT12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE |
| Gene Sequence | DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE |
| Gene ID - Mouse | ENSMUSG00000044308 |
| Gene ID - Rat | ENSRNOG00000008616 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBR3 pAb (ATL-HPA035390) | |
| Datasheet | Anti UBR3 pAb (ATL-HPA035390) Datasheet (External Link) |
| Vendor Page | Anti UBR3 pAb (ATL-HPA035390) at Atlas Antibodies |
| Documents & Links for Anti UBR3 pAb (ATL-HPA035390) | |
| Datasheet | Anti UBR3 pAb (ATL-HPA035390) Datasheet (External Link) |
| Vendor Page | Anti UBR3 pAb (ATL-HPA035390) |
| Citations for Anti UBR3 pAb (ATL-HPA035390) – 1 Found |
| Li, Tongchao; Fan, Junkai; Blanco-Sánchez, Bernardo; Giagtzoglou, Nikolaos; Lin, Guang; Yamamoto, Shinya; Jaiswal, Manish; Chen, Kuchuan; Zhang, Jie; Wei, Wei; Lewis, Michael T; Groves, Andrew K; Westerfield, Monte; Jia, Jianhang; Bellen, Hugo J. Ubr3, a Novel Modulator of Hh Signaling Affects the Degradation of Costal-2 and Kif7 through Poly-ubiquitination. Plos Genetics. 2016;12(5):e1006054. PubMed |