Anti UBLCP1 pAb (ATL-HPA039615)

Atlas Antibodies

Catalog No.:
ATL-HPA039615-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin-like domain containing CTD phosphatase 1
Gene Name: UBLCP1
Alternative Gene Name: CPUB1, MGC10067
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041231: 95%, ENSRNOG00000004477: 96%
Entrez Gene ID: 134510
Uniprot ID: Q8WVY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
Gene Sequence SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
Gene ID - Mouse ENSMUSG00000041231
Gene ID - Rat ENSRNOG00000004477
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBLCP1 pAb (ATL-HPA039615)
Datasheet Anti UBLCP1 pAb (ATL-HPA039615) Datasheet (External Link)
Vendor Page Anti UBLCP1 pAb (ATL-HPA039615) at Atlas Antibodies

Documents & Links for Anti UBLCP1 pAb (ATL-HPA039615)
Datasheet Anti UBLCP1 pAb (ATL-HPA039615) Datasheet (External Link)
Vendor Page Anti UBLCP1 pAb (ATL-HPA039615)