Anti UBLCP1 pAb (ATL-HPA039615)

Atlas Antibodies

Catalog No.: ATL-HPA039615-25

Protein Description: ubiquitin-like domain containing CTD phosphatase 1
Gene Name: UBLCP1
Alternative Gene Name: CPUB1, MGC10067
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041231: 95%, ENSRNOG00000004477: 96%
Entrez Gene ID: 134510
Uniprot ID: Q8WVY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
• Gene Sequence: SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
• Gene ID - Mouse: ENSMUSG00000041231
• Gene ID - Rat: ENSRNOG00000004477
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.