Anti UBE3C pAb (ATL-HPA039915)

Atlas Antibodies

Catalog No.:
ATL-HPA039915-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3C
Gene Name: UBE3C
Alternative Gene Name: KIAA0010, KIAA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039000: 96%, ENSRNOG00000010702: 96%
Entrez Gene ID: 9690
Uniprot ID: Q15386
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Gene Sequence VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Gene ID - Mouse ENSMUSG00000039000
Gene ID - Rat ENSRNOG00000010702
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE3C pAb (ATL-HPA039915)
Datasheet Anti UBE3C pAb (ATL-HPA039915) Datasheet (External Link)
Vendor Page Anti UBE3C pAb (ATL-HPA039915) at Atlas Antibodies

Documents & Links for Anti UBE3C pAb (ATL-HPA039915)
Datasheet Anti UBE3C pAb (ATL-HPA039915) Datasheet (External Link)
Vendor Page Anti UBE3C pAb (ATL-HPA039915)
Citations for Anti UBE3C pAb (ATL-HPA039915) – 1 Found
Tang, Li; Yi, Xue-Mei; Chen, Jia; Chen, Fu-Juan; Lou, Wei; Gao, Yun-Lu; Zhou, Jing; Su, Li-Na; Xu, Xin; Lu, Jia-Qing; Ma, Jun; Yu, Ning; Ding, Yang-Feng. Ubiquitin ligase UBE3C promotes melanoma progression by increasing epithelial-mesenchymal transition in melanoma cells. Oncotarget. 2016;7(13):15738-46.  PubMed