Anti UBE2F pAb (ATL-HPA037444)

Atlas Antibodies

Catalog No.:
ATL-HPA037444-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ubiquitin-conjugating enzyme E2F (putative)
Gene Name: UBE2F
Alternative Gene Name: NCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034343: 98%, ENSRNOG00000019953: 98%
Entrez Gene ID: 140739
Uniprot ID: Q969M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDY
Gene Sequence AYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDY
Gene ID - Mouse ENSMUSG00000034343
Gene ID - Rat ENSRNOG00000019953
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBE2F pAb (ATL-HPA037444)
Datasheet Anti UBE2F pAb (ATL-HPA037444) Datasheet (External Link)
Vendor Page Anti UBE2F pAb (ATL-HPA037444) at Atlas Antibodies

Documents & Links for Anti UBE2F pAb (ATL-HPA037444)
Datasheet Anti UBE2F pAb (ATL-HPA037444) Datasheet (External Link)
Vendor Page Anti UBE2F pAb (ATL-HPA037444)