Anti UBE2F pAb (ATL-HPA037444)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037444-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UBE2F
Alternative Gene Name: NCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034343: 98%, ENSRNOG00000019953: 98%
Entrez Gene ID: 140739
Uniprot ID: Q969M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDY |
| Gene Sequence | AYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDY |
| Gene ID - Mouse | ENSMUSG00000034343 |
| Gene ID - Rat | ENSRNOG00000019953 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBE2F pAb (ATL-HPA037444) | |
| Datasheet | Anti UBE2F pAb (ATL-HPA037444) Datasheet (External Link) |
| Vendor Page | Anti UBE2F pAb (ATL-HPA037444) at Atlas Antibodies |
| Documents & Links for Anti UBE2F pAb (ATL-HPA037444) | |
| Datasheet | Anti UBE2F pAb (ATL-HPA037444) Datasheet (External Link) |
| Vendor Page | Anti UBE2F pAb (ATL-HPA037444) |