Anti UBASH3B pAb (ATL-HPA038605)

Atlas Antibodies

Catalog No.: ATL-HPA038605-25

Protein Description: ubiquitin associated and SH3 domain containing B
Gene Name: UBASH3B
Alternative Gene Name: KIAA1959, STS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032020: 96%, ENSRNOG00000008187: 96%
Entrez Gene ID: 84959
Uniprot ID: Q8TF42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR
• Gene Sequence: AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR
• Gene ID - Mouse: ENSMUSG00000032020
• Gene ID - Rat: ENSRNOG00000008187
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBASH3B pAb (ATL-HPA038605) – 1 Found

Wang, Zijun; Wang, Yinhuai; Peng, Mou; Yi, Lu. UBASH3B Is a Novel Prognostic Biomarker and Correlated With Immune Infiltrates in Prostate Cancer. Frontiers In Oncology. 9( 32010618):1517.