Anti UBASH3A pAb (ATL-HPA035367)

Atlas Antibodies

Catalog No.: ATL-HPA035367-25

Protein Description: ubiquitin associated and SH3 domain containing A
Gene Name: UBASH3A
Alternative Gene Name: CLIP4, STS-2, TULA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042345: 87%, ENSRNOG00000001167: 88%
Entrez Gene ID: 53347
Uniprot ID: P57075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY
• Gene Sequence: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY
• Gene ID - Mouse: ENSMUSG00000042345
• Gene ID - Rat: ENSRNOG00000001167
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.