Anti UBAP1 pAb (ATL-HPA041590)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041590-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UBAP1
Alternative Gene Name: UBAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028437: 93%, ENSRNOG00000012004: 95%
Entrez Gene ID: 51271
Uniprot ID: Q9NZ09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRG |
| Gene Sequence | TMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRG |
| Gene ID - Mouse | ENSMUSG00000028437 |
| Gene ID - Rat | ENSRNOG00000012004 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBAP1 pAb (ATL-HPA041590) | |
| Datasheet | Anti UBAP1 pAb (ATL-HPA041590) Datasheet (External Link) |
| Vendor Page | Anti UBAP1 pAb (ATL-HPA041590) at Atlas Antibodies |
| Documents & Links for Anti UBAP1 pAb (ATL-HPA041590) | |
| Datasheet | Anti UBAP1 pAb (ATL-HPA041590) Datasheet (External Link) |
| Vendor Page | Anti UBAP1 pAb (ATL-HPA041590) |