Anti UBAP1 pAb (ATL-HPA041590)

Atlas Antibodies

Catalog No.:
ATL-HPA041590-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin associated protein 1
Gene Name: UBAP1
Alternative Gene Name: UBAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028437: 93%, ENSRNOG00000012004: 95%
Entrez Gene ID: 51271
Uniprot ID: Q9NZ09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRG
Gene Sequence TMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRG
Gene ID - Mouse ENSMUSG00000028437
Gene ID - Rat ENSRNOG00000012004
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBAP1 pAb (ATL-HPA041590)
Datasheet Anti UBAP1 pAb (ATL-HPA041590) Datasheet (External Link)
Vendor Page Anti UBAP1 pAb (ATL-HPA041590) at Atlas Antibodies

Documents & Links for Anti UBAP1 pAb (ATL-HPA041590)
Datasheet Anti UBAP1 pAb (ATL-HPA041590) Datasheet (External Link)
Vendor Page Anti UBAP1 pAb (ATL-HPA041590)