Anti UBA3 pAb (ATL-HPA034873)

Atlas Antibodies

Catalog No.: ATL-HPA034873-25

Protein Description: ubiquitin-like modifier activating enzyme 3
Gene Name: UBA3
Alternative Gene Name: hUba3, NAE2, UBE1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030061: 100%, ENSRNOG00000006221: 100%
Entrez Gene ID: 9039
Uniprot ID: Q8TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
• Gene Sequence: KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
• Gene ID - Mouse: ENSMUSG00000030061
• Gene ID - Rat: ENSRNOG00000006221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBA3 pAb (ATL-HPA034873) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Naik, Sanoj K; Lam, Eric W-F; Parija, Monalisa; Prakash, Surya; Jiramongkol, Yannasittha; Adhya, Amit K; Parida, Dilip K; Mishra, Sandip K. NEDDylation negatively regulates ERRβ expression to promote breast cancer tumorigenesis and progression. Cell Death & Disease. 2020;11(8):703.