Anti UAP1L1 pAb (ATL-HPA044356)

Atlas Antibodies

Catalog No.:
ATL-HPA044356-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UDP-N-acetylglucosamine pyrophosphorylase 1 like 1
Gene Name: UAP1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026956: 46%, ENSRNOG00000012960: 47%
Entrez Gene ID: 91373
Uniprot ID: Q3KQV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLPCRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGKVILER
Gene Sequence SPNWTLDPEPRCRLWSEPRLPAGPGVLAAGSPRLPCRYVMTSEFTLGPTAEFFREHNFFHLDPANVVMFEQRLLPAVTFDGKVILER
Gene ID - Mouse ENSMUSG00000026956
Gene ID - Rat ENSRNOG00000012960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UAP1L1 pAb (ATL-HPA044356)
Datasheet Anti UAP1L1 pAb (ATL-HPA044356) Datasheet (External Link)
Vendor Page Anti UAP1L1 pAb (ATL-HPA044356) at Atlas Antibodies

Documents & Links for Anti UAP1L1 pAb (ATL-HPA044356)
Datasheet Anti UAP1L1 pAb (ATL-HPA044356) Datasheet (External Link)
Vendor Page Anti UAP1L1 pAb (ATL-HPA044356)