Anti UAP1 pAb (ATL-HPA014659 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014659-25

Protein Description: UDP-N-acetylglucosamine pyrophosphorylase 1
Gene Name: UAP1
Alternative Gene Name: AgX, AGX1, SPAG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026670: 87%, ENSRNOG00000002926: 85%
Entrez Gene ID: 6675
Uniprot ID: Q16222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
• Gene Sequence: NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
• Gene ID - Mouse: ENSMUSG00000026670
• Gene ID - Rat: ENSRNOG00000002926
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UAP1 pAb (ATL-HPA014659 w/enhanced validation) – 6 Found

Ricciardiello, Francesca; Votta, Giuseppina; Palorini, Roberta; Raccagni, Isabella; Brunelli, Laura; Paiotta, Alice; Tinelli, Francesca; D'Orazio, Giuseppe; Valtorta, Silvia; De Gioia, Luca; Pastorelli, Roberta; Moresco, Rosa Maria; La Ferla, Barbara; Chiaradonna, Ferdinando. Inhibition of the Hexosamine Biosynthetic Pathway by targeting PGM3 causes breast cancer growth arrest and apoptosis. Cell Death & Disease. 2018;9(3):377. 

Itkonen, Harri M; Mills, Ian G. N-linked glycosylation supports cross-talk between receptor tyrosine kinases and androgen receptor. Plos One. 8(5):e65016. 

Lin, Yong; Wu, Chunchen; Wang, Xueyu; Liu, Shi; Zhao, Kaitao; Kemper, Thekla; Yu, Haisheng; Li, Mengqi; Zhang, Jiming; Chen, Mingzhou; Zhu, Ying; Chen, Xinwen; Lu, Mengji. Glucosamine promotes hepatitis B virus replication through its dual effects in suppressing autophagic degradation and inhibiting MTORC1 signaling. Autophagy. 2020;16(3):548-561. 

Wang, Jiachen; Wang, Zhao; Yuan, Jiaxiang; Wang, Jiaxiang; Shen, Xinsheng. The positive feedback between ACSL4 expression and O-GlcNAcylation contributes to the growth and survival of hepatocellular carcinoma. Aging. 2020;12(9):7786-7800. 

Puttamallesh, Vinuth N; Deb, Barnali; Gondkar, Kirti; Jain, Ankit; Nair, Bipin; Pandey, Akhilesh; Chatterjee, Aditi; Gowda, Harsha; Kumar, Prashant. Quantitative Proteomics of Urinary Bladder Cancer Cell Lines Identify UAP1 as a Potential Therapeutic Target. Genes. 2020;11(7) 

Ricciardiello, Francesca; Bergamaschi, Laura; De Vitto, Humberto; Gang, Yang; Zhang, Taiping; Palorini, Roberta; Chiaradonna, Ferdinando. Suppression of the HBP Function Increases Pancreatic Cancer Cell Sensitivity to a Pan-RAS Inhibitor. Cells. 2021;10(2)