Anti TXNDC11 pAb (ATL-HPA041174)

Atlas Antibodies

Catalog No.: ATL-HPA041174-25

Protein Description: thioredoxin domain containing 11
Gene Name: TXNDC11
Alternative Gene Name: EFP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022498: 85%, ENSRNOG00000002452: 88%
Entrez Gene ID: 51061
Uniprot ID: Q6PKC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQ
• Gene Sequence: PSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQ
• Gene ID - Mouse: ENSMUSG00000022498
• Gene ID - Rat: ENSRNOG00000002452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TXNDC11 pAb (ATL-HPA041174) – 1 Found

Peng, Peng; Cheng, Fangling; Dong, Yuting; Chen, Zirong; Zhang, Xiaolin; Guo, Dongsheng; Yu, Xingjiang; Lu, Yiyang; Ke, Yuyong; Zhang, Bin; He, Ximiao; Wan, Feng. High expression of TXNDC11 indicated unfavorable prognosis of glioma. Translational Cancer Research. 2021;10(12):5040-5051.