Anti TXN2 pAb (ATL-HPA000994)

Atlas Antibodies

Catalog No.: ATL-HPA000994-25

Protein Description: thioredoxin 2
Gene Name: TXN2
Alternative Gene Name: MT-TRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005354: 91%, ENSRNOG00000005614: 89%
Entrez Gene ID: 25828
Uniprot ID: Q99757
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKL
• Gene Sequence: LTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKL
• Gene ID - Mouse: ENSMUSG00000005354
• Gene ID - Rat: ENSRNOG00000005614
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TXN2 pAb (ATL-HPA000994) – 2 Found

Dammeyer, Pascal; Arnér, Elias S J. Human Protein Atlas of redox systems - what can be learnt?. Biochimica Et Biophysica Acta. 2011;1810(1):111-38. 

Ward, Nathan P; Kang, Yun Pyo; Falzone, Aimee; Boyle, Theresa A; DeNicola, Gina M. Nicotinamide nucleotide transhydrogenase regulates mitochondrial metabolism in NSCLC through maintenance of Fe-S protein function. The Journal Of Experimental Medicine. 2020;217(6)