Anti TWISTNB pAb (ATL-HPA022416 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022416-25

Protein Description: TWIST neighbor
Gene Name: TWISTNB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020561: 66%, ENSRNOG00000010750: 66%
Entrez Gene ID: 221830
Uniprot ID: Q3B726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLAD
• Gene Sequence: QTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLAD
• Gene ID - Mouse: ENSMUSG00000020561
• Gene ID - Rat: ENSRNOG00000010750
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TWISTNB pAb (ATL-HPA022416 w/enhanced validation) – 1 Found

Wei, Ting; Najmi, Saman M; Liu, Hester; Peltonen, Karita; Kucerova, Alena; Schneider, David A; Laiho, Marikki. Small-Molecule Targeting of RNA Polymerase I Activates a Conserved Transcription Elongation Checkpoint. Cell Reports. 2018;23(2):404-414.