Anti TWF1 pAb (ATL-HPA018116)

Atlas Antibodies

Catalog No.: ATL-HPA018116-25

Protein Description: twinfilin actin-binding protein 1
Gene Name: TWF1
Alternative Gene Name: A6, PTK9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022451: 92%, ENSRNOG00000022507: 93%
Entrez Gene ID: 5756
Uniprot ID: Q12792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDY
• Gene Sequence: AEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNEIIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDY
• Gene ID - Mouse: ENSMUSG00000022451
• Gene ID - Rat: ENSRNOG00000022507
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TWF1 pAb (ATL-HPA018116) – 1 Found

Tian, Chao; Zeng, Shiyan; Luo, Jing. MCTS1 Directly Binds to TWF1 and Synergistically Modulate Cyclin D1 and C-Myc Translation in Luminal A/B Breast Cancer Cells. Oncotargets And Therapy. 13( 32606753):5353-5361.