Anti TVP23B pAb (ATL-HPA019585)

Atlas Antibodies

Catalog No.: ATL-HPA019585-25

Protein Description: trans-golgi network vesicle protein 23 homolog B (S. cerevisiae)
Gene Name: TVP23B
Alternative Gene Name: CGI-148, FAM18B, FAM18B1, YDR084C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014177: 85%, ENSRNOG00000050649: 82%
Entrez Gene ID: 51030
Uniprot ID: Q9NYZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
• Gene Sequence: RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
• Gene ID - Mouse: ENSMUSG00000014177
• Gene ID - Rat: ENSRNOG00000050649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TVP23B pAb (ATL-HPA019585) – 1 Found

Wang, Ai Ling; Rao, Vidhya R; Chen, Judy J; Lussier, Yves A; Rehman, Jalees; Huang, Yong; Jager, Rama D; Grassi, Michael A. Role of FAM18B in diabetic retinopathy. Molecular Vision. 20( 25221423):1146-59.