Anti TTLL5 pAb (ATL-HPA032128)

Atlas Antibodies

Catalog No.: ATL-HPA032128-25

Protein Description: tubulin tyrosine ligase-like family, member 5
Gene Name: TTLL5
Alternative Gene Name: KIAA0998
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012609: 85%, ENSRNOG00000009318: 83%
Entrez Gene ID: 23093
Uniprot ID: Q6EMB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGP
• Gene Sequence: NKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGP
• Gene ID - Mouse: ENSMUSG00000012609
• Gene ID - Rat: ENSRNOG00000009318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.