Anti TTC9B pAb (ATL-HPA042496)

Atlas Antibodies

Catalog No.:
ATL-HPA042496-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 9B
Gene Name: TTC9B
Alternative Gene Name: FLJ30373
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007944: 91%, ENSRNOG00000018850: 91%
Entrez Gene ID: 148014
Uniprot ID: Q8N6N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAI
Gene Sequence HGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAI
Gene ID - Mouse ENSMUSG00000007944
Gene ID - Rat ENSRNOG00000018850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC9B pAb (ATL-HPA042496)
Datasheet Anti TTC9B pAb (ATL-HPA042496) Datasheet (External Link)
Vendor Page Anti TTC9B pAb (ATL-HPA042496) at Atlas Antibodies

Documents & Links for Anti TTC9B pAb (ATL-HPA042496)
Datasheet Anti TTC9B pAb (ATL-HPA042496) Datasheet (External Link)
Vendor Page Anti TTC9B pAb (ATL-HPA042496)