Anti TTC37 pAb (ATL-HPA037905)

Atlas Antibodies

Catalog No.:
ATL-HPA037905-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 37
Gene Name: TTC37
Alternative Gene Name: KIAA0372
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033991: 91%, ENSRNOG00000040297: 89%
Entrez Gene ID: 9652
Uniprot ID: Q6PGP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Gene Sequence QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Gene ID - Mouse ENSMUSG00000033991
Gene ID - Rat ENSRNOG00000040297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC37 pAb (ATL-HPA037905)
Datasheet Anti TTC37 pAb (ATL-HPA037905) Datasheet (External Link)
Vendor Page Anti TTC37 pAb (ATL-HPA037905) at Atlas Antibodies

Documents & Links for Anti TTC37 pAb (ATL-HPA037905)
Datasheet Anti TTC37 pAb (ATL-HPA037905) Datasheet (External Link)
Vendor Page Anti TTC37 pAb (ATL-HPA037905)