Anti TTC22 pAb (ATL-HPA035072)

Atlas Antibodies

Catalog No.: ATL-HPA035072-25

Protein Description: tetratricopeptide repeat domain 22
Gene Name: TTC22
Alternative Gene Name: FLJ20619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034919: 86%, ENSRNOG00000007189: 88%
Entrez Gene ID: 55001
Uniprot ID: Q5TAA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGED
• Gene Sequence: GMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGED
• Gene ID - Mouse: ENSMUSG00000034919
• Gene ID - Rat: ENSRNOG00000007189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTC22 pAb (ATL-HPA035072) – 1 Found

Tian, Wei; Du, Yantao; Ma, Yuwan; Zhang, Baozhen; Gu, Liankun; Zhou, Jing; Deng, Dajun. miR663a‑TTC22V1 axis inhibits colon cancer metastasis. Oncology Reports. 2019;41(3):1718-1728.