Anti TTC21B pAb (ATL-HPA035494)

Atlas Antibodies

Catalog No.:
ATL-HPA035494-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 21B
Gene Name: TTC21B
Alternative Gene Name: FLJ11457, IFT139, JBTS11, NPHP12, THM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034848: 83%, ENSRNOG00000005868: 72%
Entrez Gene ID: 79809
Uniprot ID: Q7Z4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG
Gene Sequence QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG
Gene ID - Mouse ENSMUSG00000034848
Gene ID - Rat ENSRNOG00000005868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TTC21B pAb (ATL-HPA035494)
Datasheet Anti TTC21B pAb (ATL-HPA035494) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA035494) at Atlas Antibodies

Documents & Links for Anti TTC21B pAb (ATL-HPA035494)
Datasheet Anti TTC21B pAb (ATL-HPA035494) Datasheet (External Link)
Vendor Page Anti TTC21B pAb (ATL-HPA035494)