Anti TTC17 pAb (ATL-HPA038508)

Atlas Antibodies

Catalog No.: ATL-HPA038508-25

Protein Description: tetratricopeptide repeat domain 17
Gene Name: TTC17
Alternative Gene Name: FLJ10890
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027194: 88%, ENSRNOG00000010495: 88%
Entrez Gene ID: 55761
Uniprot ID: Q96AE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSDAYRDKQHILWPKRADCTESYP
• Gene Sequence: DQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSDAYRDKQHILWPKRADCTESYP
• Gene ID - Mouse: ENSMUSG00000027194
• Gene ID - Rat: ENSRNOG00000010495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TTC17 pAb (ATL-HPA038508) – 2 Found

Bontems, Franck; Fish, Richard J; Borlat, Irene; Lembo, Frédérique; Chocu, Sophie; Chalmel, Frédéric; Borg, Jean-Paul; Pineau, Charles; Neerman-Arbez, Marguerite; Bairoch, Amos; Lane, Lydie. C2orf62 and TTC17 are involved in actin organization and ciliogenesis in zebrafish and human. Plos One. 9(1):e86476. 

Bassaganyas, Laia; Popa, Stephanie J; Horlbeck, Max; Puri, Claudia; Stewart, Sarah E; Campelo, Felix; Ashok, Anupama; Butnaru, Cristian M; Brouwers, Nathalie; Heydari, Kartoosh; Ripoche, Jean; Weissman, Jonathan; Rubinsztein, David C; Schekman, Randy; Malhotra, Vivek; Moreau, Kevin; Villeneuve, Julien. New factors for protein transport identified by a genome-wide CRISPRi screen in mammalian cells. The Journal Of Cell Biology. 2019;218(11):3861-3879.