Anti TSPAN16 pAb (ATL-HPA041579)

Atlas Antibodies

Catalog No.:
ATL-HPA041579-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tetraspanin 16
Gene Name: TSPAN16
Alternative Gene Name: TM-8, TM4-B, TM4SF16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027217: 34%, ENSRNOG00000008758: 34%
Entrez Gene ID: 26526
Uniprot ID: Q9UKR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Gene Sequence IVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGH
Gene ID - Mouse ENSMUSG00000027217
Gene ID - Rat ENSRNOG00000008758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSPAN16 pAb (ATL-HPA041579)
Datasheet Anti TSPAN16 pAb (ATL-HPA041579) Datasheet (External Link)
Vendor Page Anti TSPAN16 pAb (ATL-HPA041579) at Atlas Antibodies

Documents & Links for Anti TSPAN16 pAb (ATL-HPA041579)
Datasheet Anti TSPAN16 pAb (ATL-HPA041579) Datasheet (External Link)
Vendor Page Anti TSPAN16 pAb (ATL-HPA041579)