Anti TSNAX pAb (ATL-HPA031054)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031054-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TSNAX
Alternative Gene Name: TRAX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056820: 100%, ENSRNOG00000049784: 99%
Entrez Gene ID: 7257
Uniprot ID: Q99598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVK |
| Gene Sequence | ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVK |
| Gene ID - Mouse | ENSMUSG00000056820 |
| Gene ID - Rat | ENSRNOG00000049784 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSNAX pAb (ATL-HPA031054) | |
| Datasheet | Anti TSNAX pAb (ATL-HPA031054) Datasheet (External Link) |
| Vendor Page | Anti TSNAX pAb (ATL-HPA031054) at Atlas Antibodies |
| Documents & Links for Anti TSNAX pAb (ATL-HPA031054) | |
| Datasheet | Anti TSNAX pAb (ATL-HPA031054) Datasheet (External Link) |
| Vendor Page | Anti TSNAX pAb (ATL-HPA031054) |