Anti TSNAX pAb (ATL-HPA031054)

Atlas Antibodies

Catalog No.:
ATL-HPA031054-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: translin-associated factor X
Gene Name: TSNAX
Alternative Gene Name: TRAX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056820: 100%, ENSRNOG00000049784: 99%
Entrez Gene ID: 7257
Uniprot ID: Q99598
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVK
Gene Sequence ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVK
Gene ID - Mouse ENSMUSG00000056820
Gene ID - Rat ENSRNOG00000049784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSNAX pAb (ATL-HPA031054)
Datasheet Anti TSNAX pAb (ATL-HPA031054) Datasheet (External Link)
Vendor Page Anti TSNAX pAb (ATL-HPA031054) at Atlas Antibodies

Documents & Links for Anti TSNAX pAb (ATL-HPA031054)
Datasheet Anti TSNAX pAb (ATL-HPA031054) Datasheet (External Link)
Vendor Page Anti TSNAX pAb (ATL-HPA031054)