Anti TSHB pAb (ATL-HPA042681)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042681-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TSHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027857: 89%, ENSRNOG00000016793: 92%
Entrez Gene ID: 7252
Uniprot ID: P01222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF |
| Gene Sequence | CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF |
| Gene ID - Mouse | ENSMUSG00000027857 |
| Gene ID - Rat | ENSRNOG00000016793 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TSHB pAb (ATL-HPA042681) | |
| Datasheet | Anti TSHB pAb (ATL-HPA042681) Datasheet (External Link) |
| Vendor Page | Anti TSHB pAb (ATL-HPA042681) at Atlas Antibodies |
| Documents & Links for Anti TSHB pAb (ATL-HPA042681) | |
| Datasheet | Anti TSHB pAb (ATL-HPA042681) Datasheet (External Link) |
| Vendor Page | Anti TSHB pAb (ATL-HPA042681) |