Anti TSHB pAb (ATL-HPA042681)

Atlas Antibodies

Catalog No.:
ATL-HPA042681-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: thyroid stimulating hormone beta
Gene Name: TSHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027857: 89%, ENSRNOG00000016793: 92%
Entrez Gene ID: 7252
Uniprot ID: P01222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF
Gene Sequence CAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGF
Gene ID - Mouse ENSMUSG00000027857
Gene ID - Rat ENSRNOG00000016793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TSHB pAb (ATL-HPA042681)
Datasheet Anti TSHB pAb (ATL-HPA042681) Datasheet (External Link)
Vendor Page Anti TSHB pAb (ATL-HPA042681) at Atlas Antibodies

Documents & Links for Anti TSHB pAb (ATL-HPA042681)
Datasheet Anti TSHB pAb (ATL-HPA042681) Datasheet (External Link)
Vendor Page Anti TSHB pAb (ATL-HPA042681)