Anti TRMT1 pAb (ATL-HPA041380)

Atlas Antibodies

Catalog No.:
ATL-HPA041380-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 1 homolog (S. cerevisiae)
Gene Name: TRMT1
Alternative Gene Name: FLJ20244, TRM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001909: 91%, ENSRNOG00000002914: 89%
Entrez Gene ID: 55621
Uniprot ID: Q9NXH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPS
Gene Sequence LLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPS
Gene ID - Mouse ENSMUSG00000001909
Gene ID - Rat ENSRNOG00000002914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRMT1 pAb (ATL-HPA041380)
Datasheet Anti TRMT1 pAb (ATL-HPA041380) Datasheet (External Link)
Vendor Page Anti TRMT1 pAb (ATL-HPA041380) at Atlas Antibodies

Documents & Links for Anti TRMT1 pAb (ATL-HPA041380)
Datasheet Anti TRMT1 pAb (ATL-HPA041380) Datasheet (External Link)
Vendor Page Anti TRMT1 pAb (ATL-HPA041380)