Anti TRIML2 pAb (ATL-HPA043838 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043838-25

Protein Description: tripartite motif family-like 2
Gene Name: TRIML2
Alternative Gene Name: FLJ25801, SPRYD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091490: 51%, ENSRNOG00000028299: 46%
Entrez Gene ID: 205860
Uniprot ID: Q8N7C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMIESEYSMRLRLLNEECEQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLK
• Gene Sequence: KMIESEYSMRLRLLNEECEQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLK
• Gene ID - Mouse: ENSMUSG00000091490
• Gene ID - Rat: ENSRNOG00000028299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIML2 pAb (ATL-HPA043838 w/enhanced validation) – 1 Found

Kung, Che-Pei; Khaku, Sakina; Jennis, Matthew; Zhou, Yan; Murphy, Maureen E. Identification of TRIML2, a novel p53 target, that enhances p53 SUMOylation and regulates the transactivation of proapoptotic genes. Molecular Cancer Research : Mcr. 2015;13(2):250-62.