Anti TRIM77 pAb (ATL-HPA039896)

Atlas Antibodies

Catalog No.:
ATL-HPA039896-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 77
Gene Name: TRIM77
Alternative Gene Name: TRIM77P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067399: 32%, ENSRNOG00000010699: 32%
Entrez Gene ID: 390231
Uniprot ID: I1YAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFAEKQVIPTRESVPCQLSSSAMLICRRHQEIKNLICETD
Gene Sequence FCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFAEKQVIPTRESVPCQLSSSAMLICRRHQEIKNLICETD
Gene ID - Mouse ENSMUSG00000067399
Gene ID - Rat ENSRNOG00000010699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM77 pAb (ATL-HPA039896)
Datasheet Anti TRIM77 pAb (ATL-HPA039896) Datasheet (External Link)
Vendor Page Anti TRIM77 pAb (ATL-HPA039896) at Atlas Antibodies

Documents & Links for Anti TRIM77 pAb (ATL-HPA039896)
Datasheet Anti TRIM77 pAb (ATL-HPA039896) Datasheet (External Link)
Vendor Page Anti TRIM77 pAb (ATL-HPA039896)