Anti TRIM7 pAb (ATL-HPA039213)

Atlas Antibodies

Catalog No.: ATL-HPA039213-25

Protein Description: tripartite motif containing 7
Gene Name: TRIM7
Alternative Gene Name: GNIP, RNF90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040350: 86%, ENSRNOG00000002469: 83%
Entrez Gene ID: 81786
Uniprot ID: Q9C029
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
• Gene Sequence: LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
• Gene ID - Mouse: ENSMUSG00000040350
• Gene ID - Rat: ENSRNOG00000002469
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM7 pAb (ATL-HPA039213) – 2 Found

Chakraborty, Atanu; Diefenbacher, Markus E; Mylona, Anastasia; Kassel, Olivier; Behrens, Axel. The E3 ubiquitin ligase Trim7 mediates c-Jun/AP-1 activation by Ras signalling. Nature Communications. 2015;6( 25851810):6782. 

Polajnar, Mira; Dietz, Marina S; Heilemann, Mike; Behrends, Christian. Expanding the host cell ubiquitylation machinery targeting cytosolic Salmonella. Embo Reports. 2017;18(9):1572-1585.