Anti TRIM60 pAb (ATL-HPA035809)

Atlas Antibodies

Catalog No.: ATL-HPA035809-25

Protein Description: tripartite motif containing 60
Gene Name: TRIM60
Alternative Gene Name: FLJ35882, RNF129, RNF33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053490: 54%, ENSRNOG00000000785: 42%
Entrez Gene ID: 166655
Uniprot ID: Q495X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLLREVEGKSVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILDLNTAHPQ
• Gene Sequence: HLLREVEGKSVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILDLNTAHPQ
• Gene ID - Mouse: ENSMUSG00000053490
• Gene ID - Rat: ENSRNOG00000000785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.