Anti TRIM47 pAb (ATL-HPA014933)

Atlas Antibodies

Catalog No.: ATL-HPA014933-25

Protein Description: tripartite motif containing 47
Gene Name: TRIM47
Alternative Gene Name: GOA, RNF100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020773: 90%, ENSRNOG00000008215: 87%
Entrez Gene ID: 91107
Uniprot ID: Q96LD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLK
• Gene Sequence: PQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLK
• Gene ID - Mouse: ENSMUSG00000020773
• Gene ID - Rat: ENSRNOG00000008215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM47 pAb (ATL-HPA014933) – 1 Found

Han, Yudong; Tian, Haiying; Chen, Pei; Lin, Qiang. TRIM47 overexpression is a poor prognostic factor and contributes to carcinogenesis in non-small cell lung carcinoma. Oncotarget. 2017;8(14):22730-22740.