Anti TRIM43 pAb (ATL-HPA042223)

Atlas Antibodies

Catalog No.:
ATL-HPA042223-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 43
Gene Name: TRIM43
Alternative Gene Name: TRIM43A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019767: 36%, ENSRNOG00000026430: 38%
Entrez Gene ID: 129868
Uniprot ID: Q96BQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMC
Gene Sequence QHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMC
Gene ID - Mouse ENSMUSG00000019767
Gene ID - Rat ENSRNOG00000026430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM43 pAb (ATL-HPA042223)
Datasheet Anti TRIM43 pAb (ATL-HPA042223) Datasheet (External Link)
Vendor Page Anti TRIM43 pAb (ATL-HPA042223) at Atlas Antibodies

Documents & Links for Anti TRIM43 pAb (ATL-HPA042223)
Datasheet Anti TRIM43 pAb (ATL-HPA042223) Datasheet (External Link)
Vendor Page Anti TRIM43 pAb (ATL-HPA042223)