Anti TRIM40 pAb (ATL-HPA043818)

Atlas Antibodies

Catalog No.:
ATL-HPA043818-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 40
Gene Name: TRIM40
Alternative Gene Name: RNF35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073399: 48%, ENSRNOG00000000783: 48%
Entrez Gene ID: 135644
Uniprot ID: Q6P9F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQP
Gene Sequence QQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQP
Gene ID - Mouse ENSMUSG00000073399
Gene ID - Rat ENSRNOG00000000783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM40 pAb (ATL-HPA043818)
Datasheet Anti TRIM40 pAb (ATL-HPA043818) Datasheet (External Link)
Vendor Page Anti TRIM40 pAb (ATL-HPA043818) at Atlas Antibodies

Documents & Links for Anti TRIM40 pAb (ATL-HPA043818)
Datasheet Anti TRIM40 pAb (ATL-HPA043818) Datasheet (External Link)
Vendor Page Anti TRIM40 pAb (ATL-HPA043818)