Anti TRIM24 pAb (ATL-HPA043495 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043495-25

Protein Description: tripartite motif containing 24
Gene Name: TRIM24
Alternative Gene Name: hTIF1, RNF82, TIF1, Tif1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029833: 94%, ENSRNOG00000013251: 92%
Entrez Gene ID: 8805
Uniprot ID: O15164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSA
• Gene Sequence: SSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSA
• Gene ID - Mouse: ENSMUSG00000029833
• Gene ID - Rat: ENSRNOG00000013251
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM24 pAb (ATL-HPA043495 w/enhanced validation) – 1 Found

Theurillat, Jean-Philippe P; Udeshi, Namrata D; Errington, Wesley J; Svinkina, Tanya; Baca, Sylvan C; Pop, Marius; Wild, Peter J; Blattner, Mirjam; Groner, Anna C; Rubin, Mark A; Moch, Holger; Prive, Gilbert G; Carr, Steven A; Garraway, Levi A. Prostate cancer. Ubiquitylome analysis identifies dysregulation of effector substrates in SPOP-mutant prostate cancer. Science (New York, N.y.). 2014;346(6205):85-89.