Anti TRIM23 pAb (ATL-HPA039605)

Atlas Antibodies

Catalog No.: ATL-HPA039605-25

Protein Description: tripartite motif containing 23
Gene Name: TRIM23
Alternative Gene Name: ARD1, ARFD1, RNF46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021712: 92%, ENSRNOG00000012354: 94%
Entrez Gene ID: 373
Uniprot ID: P36406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
• Gene Sequence: LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
• Gene ID - Mouse: ENSMUSG00000021712
• Gene ID - Rat: ENSRNOG00000012354
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM23 pAb (ATL-HPA039605) – 2 Found

Watanabe, Masashi; Takahashi, Hidehisa; Saeki, Yasushi; Ozaki, Takashi; Itoh, Shihori; Suzuki, Masanobu; Mizushima, Wataru; Tanaka, Keiji; Hatakeyama, Shigetsugu. The E3 ubiquitin ligase TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPARγ. Elife. 2015;4( 25905670):e05615. 

Han, Yudong; Tan, Ye; Zhao, Yuanyuan; Zhang, Yongchun; He, Xinjia; Yu, Li; Jiang, Haiping; Lu, Haijun; Tian, Haiying. TRIM23 overexpression is a poor prognostic factor and contributes to carcinogenesis in colorectal cancer. Journal Of Cellular And Molecular Medicine. 2020;24(10):5491-5500.