Anti TRIM2 pAb (ATL-HPA035854)

Atlas Antibodies

Catalog No.:
ATL-HPA035854-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 2
Gene Name: TRIM2
Alternative Gene Name: KIAA0517, RNF86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027993: 100%, ENSRNOG00000010124: 100%
Entrez Gene ID: 23321
Uniprot ID: Q9C040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK
Gene Sequence KASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHK
Gene ID - Mouse ENSMUSG00000027993
Gene ID - Rat ENSRNOG00000010124
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TRIM2 pAb (ATL-HPA035854)
Datasheet Anti TRIM2 pAb (ATL-HPA035854) Datasheet (External Link)
Vendor Page Anti TRIM2 pAb (ATL-HPA035854) at Atlas Antibodies

Documents & Links for Anti TRIM2 pAb (ATL-HPA035854)
Datasheet Anti TRIM2 pAb (ATL-HPA035854) Datasheet (External Link)
Vendor Page Anti TRIM2 pAb (ATL-HPA035854)