Anti TRIM10 pAb (ATL-HPA043325)

Atlas Antibodies

Catalog No.: ATL-HPA043325-25

Protein Description: tripartite motif containing 10
Gene Name: TRIM10
Alternative Gene Name: HERF1, RFB30, RNF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073400: 75%, ENSRNOG00000000782: 73%
Entrez Gene ID: 10107
Uniprot ID: Q9UDY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLVAGEICRFS
• Gene Sequence: IQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLVAGEICRFS
• Gene ID - Mouse: ENSMUSG00000073400
• Gene ID - Rat: ENSRNOG00000000782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.