Anti TRERF1 pAb (ATL-HPA027771)

Atlas Antibodies

Catalog No.: ATL-HPA027771-25

Protein Description: transcriptional regulating factor 1
Gene Name: TRERF1
Alternative Gene Name: BCAR2, dJ139D8.5, HSA277276, RAPA, TReP-132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042507: 48%, ENSRNOG00000022598: 94%
Entrez Gene ID: 55809
Uniprot ID: Q96PN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC
• Gene Sequence: QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC
• Gene ID - Mouse: ENSMUSG00000042507
• Gene ID - Rat: ENSRNOG00000022598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.